SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tuwb2 (5tuw B:174-311)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162741Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2162742Protein automated matches [190205] (26 species)
    not a true protein
  7. 2162828Species Synechocystis sp. [TaxId:1111708] [275032] (4 PDB entries)
  8. 2291883Domain d5tuwb2: 5tuw B:174-311 [335184]
    Other proteins in same PDB: d5tuwa1, d5tuwb1, d5tuwc1, d5tuwd1, d5tuwe1, d5tuwf1
    automated match to d1m98a2
    complexed with eq3, gol

Details for d5tuwb2

PDB Entry: 5tuw (more details), 2.3 Å

PDB Description: crystal structure of orange carotenoid protein with partial loss of 3'oh echinenone chromophore
PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuwb2 d.17.4.0 (B:174-311) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

SCOPe Domain Coordinates for d5tuwb2:

Click to download the PDB-style file with coordinates for d5tuwb2.
(The format of our PDB-style files is described here.)

Timeline for d5tuwb2:

  • d5tuwb2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08