SCOPe 2.08: Domain d5tv0a2: 5tv0 A:174-312

Lineage for d5tv0a2 (5tv0 A:174-312)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [275032] (5 PDB entries)

8. Domain d5tv0a2: 5tv0 A:174-312 [335180]
   Other proteins in same PDB: d5tv0a1
   automated match to d1m98a2
   complexed with eq3, gol

Details for d5tv0a2

PDB Entry: 5tv0, 1.65 Å

PDB Description: crystal structure and light induced structural changes in orange carotenoid protein bound with 3 'oh echinenone

PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tv0a2:

Sequence; same for both SEQRES and ATOM records:

>d5tv0a2 d.17.4.0 (A:174-312) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkel

Timeline for d5tv0a2:

• d5tv0a2 first appeared in SCOPe 2.06
  
• d5tv0a2 appears in SCOPe 2.07