Lineage for d5tv0a1 (5tv0 A:2-173)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014191Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2014192Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2014193Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 protein domains)
  6. 2014198Protein automated matches [227037] (2 species)
    not a true protein
  7. 2014199Species Synechocystis sp. [TaxId:1111708] [275030] (4 PDB entries)
  8. 2291878Domain d5tv0a1: 5tv0 A:2-173 [335179]
    Other proteins in same PDB: d5tv0a2
    automated match to d1m98a1
    complexed with eq3, gol

Details for d5tv0a1

PDB Entry: 5tv0 (more details), 1.65 Å

PDB Description: crystal structure and light induced structural changes in orange carotenoid protein bound with 3 'oh echinenone
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tv0a1:

Sequence, based on SEQRES records: (download)

>d5tv0a1 a.175.1.1 (A:2-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
pftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasm
qlaenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgf
vapipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d5tv0a1 a.175.1.1 (A:2-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
pftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasm
qlaenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgf
vapipagyqlsananavlatiqglesgqqitvlrnavvdmgfria

SCOPe Domain Coordinates for d5tv0a1:

Click to download the PDB-style file with coordinates for d5tv0a1.
(The format of our PDB-style files is described here.)

Timeline for d5tv0a1:

  • d5tv0a1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5tv0a2