SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ncea_ (5nce A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2229881Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2291874Family g.3.7.0: automated matches [335175] (1 protein)
    not a true family
  6. 2291875Protein automated matches [335176] (1 species)
    not a true protein
  7. 2291876Species Pinus sylvestris [TaxId:3349] [335177] (1 PDB entry)
  8. 2291877Domain d5ncea_: 5nce A: [335178]
    automated match to d1gpta_

Details for d5ncea_

PDB Entry: 5nce (more details)

PDB Description: structure of psdef1 defensin from pinus sylvestris
PDB Compounds: (A:) Defensin-1

SCOPe Domain Sequences for d5ncea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ncea_ g.3.7.0 (A:) automated matches {Pinus sylvestris [TaxId: 3349]}
rmcktpsgkfkgycvnntncknvcrtegfptgscdfhvagrkcycykpcp

SCOPe Domain Coordinates for d5ncea_:

Click to download the PDB-style file with coordinates for d5ncea_.
(The format of our PDB-style files is described here.)

Timeline for d5ncea_:

  • d5ncea_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08