Lineage for d5ncea_ (5nce A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2229881Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2291874Family g.3.7.0: automated matches [335175] (1 protein)
    not a true family
  6. 2291875Protein automated matches [335176] (1 species)
    not a true protein
  7. 2291876Species Pinus sylvestris [TaxId:3349] [335177] (1 PDB entry)
  8. 2291877Domain d5ncea_: 5nce A: [335178]
    automated match to d1gpta_

Details for d5ncea_

PDB Entry: 5nce (more details)

PDB Description: structure of psdef1 defensin from pinus sylvestris
PDB Compounds: (A:) Defensin-1

SCOPe Domain Sequences for d5ncea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ncea_ g.3.7.0 (A:) automated matches {Pinus sylvestris [TaxId: 3349]}
rmcktpsgkfkgycvnntncknvcrtegfptgscdfhvagrkcycykpcp

SCOPe Domain Coordinates for d5ncea_:

Click to download the PDB-style file with coordinates for d5ncea_.
(The format of our PDB-style files is described here.)

Timeline for d5ncea_:

  • d5ncea_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08