SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ut4a_ (5ut4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (813 PDB entries)
  8. 2291870Domain d5ut4a_: 5ut4 A: [335171]
    automated match to d1ir3a_
    complexed with dms, dqx, gol

Details for d5ut4a_

PDB Entry: 5ut4 (more details), 2 Å

PDB Description: jak2 jh2 in complex with nvp-bsk805
PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d5ut4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ut4a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
aasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevakq
laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
aaelanlinncmdyepdhrpsfraiirdlnslf

SCOPe Domain Coordinates for d5ut4a_:

Click to download the PDB-style file with coordinates for d5ut4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ut4a_:

  • d5ut4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08