SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nw3a_ (5nw3 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2235033Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2235239Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2235240Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. 2235249Protein Rubredoxin [57804] (8 species)
  7. 2235310Species Pyrococcus furiosus [TaxId:2261] [57809] (28 PDB entries)
    Uniprot P24297
  8. 2291862Domain d5nw3a_: 5nw3 A: [335163]
    automated match to d1bq8a_
    complexed with fe, k, na, po4

Details for d5nw3a_

PDB Entry: 5nw3 (more details), 0.59 Å

PDB Description: the cryofrozen atomic resolution x-ray crystal structure of perdeuterated pyrococcus furiosus rubredoxin (100k, 0.59a resolution)
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d5nw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw3a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d5nw3a_:

Click to download the PDB-style file with coordinates for d5nw3a_.
(The format of our PDB-style files is described here.)

Timeline for d5nw3a_:

  • d5nw3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08