Lineage for d5nw3a_ (5nw3 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2235033Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2235239Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2235240Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. 2235249Protein Rubredoxin [57804] (8 species)
  7. 2235310Species Pyrococcus furiosus [TaxId:2261] [57809] (28 PDB entries)
    Uniprot P24297
  8. 2291862Domain d5nw3a_: 5nw3 A: [335163]
    automated match to d1bq8a_
    complexed with fe, k, na, po4

Details for d5nw3a_

PDB Entry: 5nw3 (more details), 0.59 Å

PDB Description: the cryofrozen atomic resolution x-ray crystal structure of perdeuterated pyrococcus furiosus rubredoxin (100k, 0.59a resolution)
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d5nw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nw3a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d5nw3a_:

Click to download the PDB-style file with coordinates for d5nw3a_.
(The format of our PDB-style files is described here.)

Timeline for d5nw3a_:

  • d5nw3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08