Lineage for d5b7hb1 (5b7h B:86-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916423Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries)
  8. 2916425Domain d5b7hb1: 5b7h B:86-301 [335155]
    Other proteins in same PDB: d5b7ha2, d5b7hb2
    automated match to d1i69a_
    complexed with so4; mutant

Details for d5b7hb1

PDB Entry: 5b7h (more details), 1.49 Å

PDB Description: oxyr2 regulatory domain c206s mutant from vibrio vulnificus
PDB Compounds: (B:) LysR family transcriptional regulator

SCOPe Domain Sequences for d5b7hb1:

Sequence, based on SEQRES records: (download)

>d5b7hb1 c.94.1.0 (B:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
elgslcqgdsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrh
geldvlilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekeh
sltehavsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvi
eppgqqayrdiglvwrpsssrsktfnqlaevvsell

Sequence, based on observed residues (ATOM records): (download)

>d5b7hb1 c.94.1.0 (B:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
eldsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvl
ilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekehslteha
vsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqq
ayrdiglvwrpsssrsktfnqlaevvsell

SCOPe Domain Coordinates for d5b7hb1:

Click to download the PDB-style file with coordinates for d5b7hb1.
(The format of our PDB-style files is described here.)

Timeline for d5b7hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5b7hb2