SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1lb_ (5k1l B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978505Protein automated matches [190359] (42 species)
    not a true protein
  7. 1978506Species Amphitrite ornata [TaxId:129555] [189339] (6 PDB entries)
  8. 2291853Domain d5k1lb_: 5k1l B: [335154]
    automated match to d4kn3a_
    complexed with bzi, hem, so4

Details for d5k1lb_

PDB Entry: 5k1l (more details), 1.08 Å

PDB Description: dehaloperoxidase b from amphitrite ornata: benzimidazole complex
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5k1lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1lb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5k1lb_:

Click to download the PDB-style file with coordinates for d5k1lb_.
(The format of our PDB-style files is described here.)

Timeline for d5k1lb_:

  • d5k1lb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08