Lineage for d5u36b1 (5u36 B:2-306)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105607Protein automated matches [190581] (9 species)
    not a true protein
  7. 2105626Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (10 PDB entries)
  8. 2291850Domain d5u36b1: 5u36 B:2-306 [335151]
    Other proteins in same PDB: d5u36a2, d5u36b2
    automated match to d1u7xa_
    mutant

Details for d5u36b1

PDB Entry: 5u36 (more details), 3.03 Å

PDB Description: crystal structure of a mutant m. jannashii tyrosyl-trna synthetase
PDB Compounds: (B:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5u36b1:

Sequence, based on SEQRES records: (download)

>d5u36b1 c.26.1.1 (B:2-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
iiialadlhaylnqkgeldeirkigdynkkvfeamglkakyvygsekhldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvngihykgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

Sequence, based on observed residues (ATOM records): (download)

>d5u36b1 c.26.1.1 (B:2-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
iiialadlhayeldeirkigdynkkvfeamglkakyvygsldkdytlnvyrlalkttlkr
arrsmeliarpkvaeviypimqvngihykgvdvavggmeqrkihmlarellpkkvvcihn
pvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypl
tikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl

SCOPe Domain Coordinates for d5u36b1:

Click to download the PDB-style file with coordinates for d5u36b1.
(The format of our PDB-style files is described here.)

Timeline for d5u36b1:

  • d5u36b1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5u36b2