SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n93a1 (5n93 A:519-794)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (808 PDB entries)
  8. 2291837Domain d5n93a1: 5n93 A:519-794 [335138]
    Other proteins in same PDB: d5n93a2
    automated match to d3dbqa_
    complexed with 8qe

Details for d5n93a1

PDB Entry: 5n93 (more details), 2.1 Å

PDB Description: ttk kinase domain in complex with tc-mps1-12
PDB Compounds: (A:) Dual specificity protein kinase TTK

SCOPe Domain Sequences for d5n93a1:

Sequence, based on SEQRES records: (download)

>d5n93a1 d.144.1.0 (A:519-794) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl
qqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleavhti
hqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppeaikdm
sssrengkskskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpd
ipekdlqdvlkcclkrdpkqrisipellahpyvqiq

Sequence, based on observed residues (ATOM records): (download)

>d5n93a1 d.144.1.0 (A:519-794) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl
qqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmleavhti
hqhgivhsdlkpanflivdgmlklidfgianqmqpdvgtvnymppeaikdmskispksdv
wslgcilyymtygktpfqqiinqisklhaiidpnheiefpdipekdlqdvlkcclkrdpk
qrisipellahpyvqiq

SCOPe Domain Coordinates for d5n93a1:

Click to download the PDB-style file with coordinates for d5n93a1.
(The format of our PDB-style files is described here.)

Timeline for d5n93a1:

  • d5n93a1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

2291837
d5n93a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5n93a2