SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i05a_ (5i05 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232868Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2232869Protein automated matches [190506] (3 species)
    not a true protein
  7. 2232870Species Human (Homo sapiens) [TaxId:9606] [187459] (20 PDB entries)
  8. 2291836Domain d5i05a_: 5i05 A: [335137]
    automated match to d1m4ul_
    complexed with gol

Details for d5i05a_

PDB Entry: 5i05 (more details), 1.87 Å

PDB Description: crystal structure of human bmp9 at 1.87 a resolution
PDB Compounds: (A:) Growth/differentiation factor 2

SCOPe Domain Sequences for d5i05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i05a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr

SCOPe Domain Coordinates for d5i05a_:

Click to download the PDB-style file with coordinates for d5i05a_.
(The format of our PDB-style files is described here.)

Timeline for d5i05a_:

  • d5i05a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08