Lineage for d5i05a_ (5i05 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232868Family g.17.1.0: automated matches [191392] (1 protein)
    not a true family
  6. 2232869Protein automated matches [190506] (3 species)
    not a true protein
  7. 2232870Species Human (Homo sapiens) [TaxId:9606] [187459] (22 PDB entries)
  8. 2291836Domain d5i05a_: 5i05 A: [335137]
    automated match to d1m4ul_
    complexed with gol

Details for d5i05a_

PDB Entry: 5i05 (more details), 1.87 Å

PDB Description: crystal structure of human bmp9 at 1.87 a resolution
PDB Compounds: (A:) Growth/differentiation factor 2

SCOPe Domain Sequences for d5i05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i05a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agshcqktslrvnfedigwdswiiapkeyeayeckggcffpladdvtptkhaivqtlvhl
kfptkvgkaccvptklspisvlykddmgvptlkyhyegmsvaecgcr

SCOPe Domain Coordinates for d5i05a_:

Click to download the PDB-style file with coordinates for d5i05a_.
(The format of our PDB-style files is described here.)

Timeline for d5i05a_:

  • d5i05a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08