SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u36a1 (5u36 A:2-306)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105607Protein automated matches [190581] (9 species)
    not a true protein
  7. 2105626Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (9 PDB entries)
  8. 2291834Domain d5u36a1: 5u36 A:2-306 [335135]
    Other proteins in same PDB: d5u36a2, d5u36b2
    automated match to d1u7xa_
    mutant

Details for d5u36a1

PDB Entry: 5u36 (more details), 3.03 Å

PDB Description: crystal structure of a mutant m. jannashii tyrosyl-trna synthetase
PDB Compounds: (A:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5u36a1:

Sequence, based on SEQRES records: (download)

>d5u36a1 c.26.1.1 (A:2-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
iiialadlhaylnqkgeldeirkigdynkkvfeamglkakyvygsekhldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvngihykgvdvavggmeqrkihmlar
ellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrl

Sequence, based on observed residues (ATOM records): (download)

>d5u36a1 c.26.1.1 (A:2-306) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
defemikrntseiiseeelrevlkkdeksasigfepsgkihlghylqikkmidlqnagfd
iiialadlhayeldeirkigdynkkvfeamglkakyvygsldkdytlnvyrlalkttlkr
arrsmeliarpkvaeviypimqvngihykgvdvavggmeqrkihmlarellpkkvvcihn
pvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpimeiakyfleypl
tikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilepirkrl

SCOPe Domain Coordinates for d5u36a1:

Click to download the PDB-style file with coordinates for d5u36a1.
(The format of our PDB-style files is described here.)

Timeline for d5u36a1:

  • d5u36a1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5u36a2