Lineage for d5ghba_ (5ghb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931492Protein SUMO-2 [117816] (1 species)
  7. 2931493Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries)
    Uniprot P61956
  8. 2931505Domain d5ghba_: 5ghb A: [335131]
    automated match to d2awta_

Details for d5ghba_

PDB Entry: 5ghb (more details)

PDB Description: solution structure of lys42 acetylated human sumo2
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d5ghba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghba_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtgg

SCOPe Domain Coordinates for d5ghba_:

Click to download the PDB-style file with coordinates for d5ghba_.
(The format of our PDB-style files is described here.)

Timeline for d5ghba_: