Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-2 [117816] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries) Uniprot P61956 |
Domain d5ghba_: 5ghb A: [335131] automated match to d2awta_ |
PDB Entry: 5ghb (more details)
SCOPe Domain Sequences for d5ghba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ghba_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf rfdgqpinetdtpaqlemededtidvfqqqtgg
Timeline for d5ghba_: