SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l3kh_ (5l3k H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2290797Species Mycobacterium thermoresistibile [TaxId:1797] [334098] (4 PDB entries)
  8. 2291828Domain d5l3kh_: 5l3k H: [335129]
    automated match to d5hxaa_
    complexed with adp, edo, f6p, po4

Details for d5l3kh_

PDB Entry: 5l3k (more details), 2.31 Å

PDB Description: structure of mycobacterium thermoresistibile trehalose-6-phosphate synthase in a ternary complex with adp and fructose-6-phosphate
PDB Compounds: (H:) alpha,alpha-trehalose-phosphate synthase

SCOPe Domain Sequences for d5l3kh_:

Sequence, based on SEQRES records: (download)

>d5l3kh_ c.87.1.0 (H:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
dsdfvvvanrlpidlerapdgttswkrspgglvtalepllrrrrgawigwpgipdsdedp
ivdgdlvlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfae
atsraaargatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitd
gllgadlvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafpis
idsadldrqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellaegr
vnredtvfvqlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpreel
iaffvaadvmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnl
dhvkdtmvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastr

Sequence, based on observed residues (ATOM records): (download)

>d5l3kh_ c.87.1.0 (H:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
dsdfvvvanrlpidlekrspgglvtalepllgawigwpgipdvdgdlvlypvrlsaddva
qyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfaeatsraaargatvwvqdyql
qlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitdgllgadlvgfhlpggaqnf
lflarrlvgantsrasvgvrskfgevqigsrtvkvgafpisidsadldrqarqrsirqra
rqiraelgnprrillgvdrldytkgidvrlqafaellaegrvnredtvfvqlatpsrerv
eayrllrddierqvghingeygevghpvvhylhrpvpreeliaffvaadvmlvtplrdgm
nlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnldhvkdtmvaalnqtpeegr
rrmralrrqvlahdvdlwarsfldalastr

SCOPe Domain Coordinates for d5l3kh_:

Click to download the PDB-style file with coordinates for d5l3kh_.
(The format of our PDB-style files is described here.)

Timeline for d5l3kh_:

  • d5l3kh_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08