Lineage for d5l3ka_ (5l3k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2290797Species Mycobacterium thermoresistibile [TaxId:1797] [334098] (7 PDB entries)
  8. 2291822Domain d5l3ka_: 5l3k A: [335123]
    automated match to d5hxaa_
    complexed with adp, edo, f6p, po4

Details for d5l3ka_

PDB Entry: 5l3k (more details), 2.31 Å

PDB Description: structure of mycobacterium thermoresistibile trehalose-6-phosphate synthase in a ternary complex with adp and fructose-6-phosphate
PDB Compounds: (A:) alpha,alpha-trehalose-phosphate synthase

SCOPe Domain Sequences for d5l3ka_:

Sequence, based on SEQRES records: (download)

>d5l3ka_ c.87.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
sdfvvvanrlpidlerapdgttswkrspgglvtalepllrrrrgawigwpgipdsdedpi
vdgdlvlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfaea
tsraaargatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitdg
llgadlvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafpisi
dsadldrqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellaegrv
nredtvfvqlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpreeli
affvaadvmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnld
hvkdtmvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastr

Sequence, based on observed residues (ATOM records): (download)

>d5l3ka_ c.87.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
sdfvvvanrlpidlrspgglvtalepllrrawigwpgipdsdedpvlypvrlsaddvaqy
yegfsnatlwplyhdvivkpiynrqwweryvevnrrfaeatsraaargatvwvqdyqlql
vpkmlrelrpdltigfflhipfppvelfmqlpwrteitdgllgadlvgfhlpggaqnflf
larrlvgantsrasvgvrskfgevqigsrtvkvgafpisidsadldrqarqrsirqrarq
iraelgnprrillgvdrldytkgidvrlqafaellaegrvnredtvfvqlatpsrervea
yrllrddierqvghingeygevghpvvhylhrpvpreeliaffvaadvmlvtplrdgmnl
vakeyvacrsdlggalvlseftgaaaelgqaylvnphnldhvkdtmvaalnqtpeegrrr
mralrrqvlahdvdlwarsfldalastr

SCOPe Domain Coordinates for d5l3ka_:

Click to download the PDB-style file with coordinates for d5l3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5l3ka_:

  • d5l3ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08