SCOPe 2.06: Domain d5t7db_: 5t7d B:

Lineage for d5t7db_ (5t7d B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Streptomyces hygroscopicus [TaxId:1912] [335112] (2 PDB entries)

8. Domain d5t7db_: 5t7d B: [335120]
   automated match to d1yr0a1
   complexed with aco, act

Details for d5t7db_

PDB Entry: 5t7d, 1.4 Å

PDB Description: crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a

PDB Compounds: (B:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5t7db_:

Sequence; same for both SEQRES and ATOM records:

>d5t7db_ d.108.1.0 (B:) automated matches {Streptomyces hygroscopicus [TaxId: 1912]}
adirrateadmpavctivnhyietstvnfrtepqepqewtddlvrlrerypwlvaevdge
vagiayagpwkarnaydwtaestvyvsprhqrtglgstlythllksleaqgfksvvavig
lpndpsvrmhealgyaprgmlraagfkhgnwhdvgfwqldfslpvpprpvlpv

Timeline for d5t7db_:

• d5t7db_ is new in SCOPe 2.06-stable
  
• d5t7db_ appears in SCOPe 2.07
  
• d5t7db_ appears in the current release, SCOPe 2.08