SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nm0c_ (5nm0 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (128 PDB entries)
  8. 2291818Domain d5nm0c_: 5nm0 C: [335119]
    Other proteins in same PDB: d5nm0a2, d5nm0b2
    automated match to d3ogog_
    complexed with hg

Details for d5nm0c_

PDB Entry: 5nm0 (more details), 1.5 Å

PDB Description: nb36 ser85cys with hg, crystal form 1
PDB Compounds: (C:) Nb36

SCOPe Domain Sequences for d5nm0c_:

Sequence, based on SEQRES records: (download)

>d5nm0c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d5nm0c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgatvwgqgtqvtvs

SCOPe Domain Coordinates for d5nm0c_:

Click to download the PDB-style file with coordinates for d5nm0c_.
(The format of our PDB-style files is described here.)

Timeline for d5nm0c_:

  • d5nm0c_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08