SCOPe 2.06: Domain d5k1ka_: 5k1k A:

Lineage for d5k1ka_ (5k1k A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (21 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries)

8. Domain d5k1ka_: 5k1k A: [335111]
   automated match to d3kruc_
   complexed with 8k6, fmn, hba

Details for d5k1ka_

PDB Entry: 5k1k, 1.3 Å

PDB Description: crystal structure of oxidized shewanella yellow enzyme 4 (sye4) in complex with p-hydroxybenzaldehyde

PDB Compounds: (A:) NAD(P)H:flavin oxidoreductase Sye4

SCOPe Domain Sequences for d5k1ka_:

Sequence; same for both SEQRES and ATOM records:

>d5k1ka_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
svenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagliiseati
irpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphffgggdvla
psaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgveihgangyl
idqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayfnmasdsr
drvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgvgsysaet
askaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli

Timeline for d5k1ka_:

• d5k1ka_ is new in SCOPe 2.06-stable
  
• d5k1ka_ appears in SCOPe 2.07
  
• d5k1ka_ appears in the current release, SCOPe 2.08