Lineage for d5nxla1 (5nxl A:20-302)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (16 species)
    not a true protein
  7. 2291792Species Thermomonospora curvata [TaxId:471852] [335093] (2 PDB entries)
  8. 2291805Domain d5nxla1: 5nxl A:20-302 [335106]
    Other proteins in same PDB: d5nxla2
    automated match to d1y1hx_
    complexed with act, ag, ca, mpd

Details for d5nxla1

PDB Entry: 5nxl (more details), 1.66 Å

PDB Description: formylglycine generating enzyme from t. curvata in complex with ag(i)
PDB Compounds: (A:) Non-specific serine/threonine protein kinase

SCOPe Domain Sequences for d5nxla1:

Sequence, based on SEQRES records: (download)

>d5nxla1 d.169.1.0 (A:20-302) automated matches {Thermomonospora curvata [TaxId: 471852]}
mvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsnrqfaafvkatgyvtda
erygwsfvfhahvapgtpvmdavvpeapwwvavpgaywkapegpgssitdrpnhpvvhvs
wndavayatwagkrlpteaewemaarggldqarypwgneltprgrhrcniwqgtfpvhdt
gedgytgtapvnafapngyglynvagnvwewcadwwsadwhatespatridprgpetgta
rvtkggsflchesycnryrvaartcntpdssaahtgfrcaadp

Sequence, based on observed residues (ATOM records): (download)

>d5nxla1 d.169.1.0 (A:20-302) automated matches {Thermomonospora curvata [TaxId: 471852]}
mvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsnrqfaafvkatgyvtda
erygwsfvfhahvdavvpeapwwvavpgaywkapegpgssitdrpnhpvvhvswndavay
atwagkrlpteaewemaarggldqarypwgneltprgrhrcniwqgtfpvhdtgedgytg
tapvnafapngyglynvagnvwewcadwwsadwhatespatridprgpetgtarvtkggs
flchesycnryrvaartcntpdssaahtgfrcaadp

SCOPe Domain Coordinates for d5nxla1:

Click to download the PDB-style file with coordinates for d5nxla1.
(The format of our PDB-style files is described here.)

Timeline for d5nxla1:

  • d5nxla1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5nxla2