SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5ad2 (5g5a D:84-220)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2281311Species Arabidopsis thaliana [TaxId:3702] [324612] (12 PDB entries)
  8. 2291802Domain d5g5ad2: 5g5a D:84-220 [335103]
    Other proteins in same PDB: d5g5aa1, d5g5ab1, d5g5ac1, d5g5ad1
    automated match to d5agya2
    complexed with gsh

Details for d5g5ad2

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide
PDB Compounds: (D:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ad2 a.45.1.0 (D:84-220) automated matches {Arabidopsis thaliana [TaxId: 3702]}
llpsdpyqraqakfwgdfidkkvyasarliwgakgeeheagkkefieilktleselgdkt
yfggetfgyvdialigfyswfeayekfgsfsieaecpkliawgkrcveresvakslpdse
kiikfvpelrkklgiei

SCOPe Domain Coordinates for d5g5ad2:

Click to download the PDB-style file with coordinates for d5g5ad2.
(The format of our PDB-style files is described here.)

Timeline for d5g5ad2:

  • d5g5ad2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08