SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ghca_ (5ghc A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158943Protein automated matches [190118] (11 species)
    not a true protein
  7. 2158968Species Human (Homo sapiens) [TaxId:9606] [189560] (90 PDB entries)
  8. 2291800Domain d5ghca_: 5ghc A: [335101]
    automated match to d2awta_

Details for d5ghca_

PDB Entry: 5ghc (more details)

PDB Description: solution structure of lys33 acetylated human sumo2
PDB Compounds: (A:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d5ghca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghca_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
rfdgqpinetdtpaqlemededtidvfqqqtgg

SCOPe Domain Coordinates for d5ghca_:

Click to download the PDB-style file with coordinates for d5ghca_.
(The format of our PDB-style files is described here.)

Timeline for d5ghca_:

  • d5ghca_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08