Lineage for d5k56a_ (5k56 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 protein domains)
  6. 2570953Protein automated matches [190281] (5 species)
    not a true protein
  7. 2570957Species Human (Homo sapiens) [TaxId:9606] [187709] (25 PDB entries)
  8. 2571024Domain d5k56a_: 5k56 A: [335100]
    automated match to d1fsaa_
    complexed with fbp

Details for d5k56a_

PDB Entry: 5k56 (more details), 2.2 Å

PDB Description: human muscle fructose-1,6-bisphosphatase in active r-state in complex with fructose-1,6-bisphosphate
PDB Compounds: (A:) Fructose-1,6-bisphosphatase isozyme 2

SCOPe Domain Sequences for d5k56a_:

Sequence, based on SEQRES records: (download)

>d5k56a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygiagsvnvtgd
evkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpldgssnidc
lasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqgvdlfmldp
algefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapygaryvgsm
vadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtqpvldvkpe
aihqrvplilgspedvqeyltcvqkn

Sequence, based on observed residues (ATOM records): (download)

>d5k56a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltreltqllnsmltaikaissavkkldvlsnslvinmlqssystcvlvseenkdai
itakekrgkyvvcfdpldgasigtifaiyekdalqcgrnivaagyalygsatlvalstgq
gvdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsap
ygaryvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgt
qpvldvkpeaihqrvplilgspedvqeyltcvqkn

SCOPe Domain Coordinates for d5k56a_:

Click to download the PDB-style file with coordinates for d5k56a_.
(The format of our PDB-style files is described here.)

Timeline for d5k56a_: