SCOPe 2.06: Domain d5nd5b2: 5nd5 B:388-579

Lineage for d5nd5b2 (5nd5 B:388-579)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (20 species)
   not a true protein

7. Species Chlamydomonas reinhardtii [TaxId:3055] [335084] (2 PDB entries)

8. Domain d5nd5b2: 5nd5 B:388-579 [335098]
   Other proteins in same PDB: d5nd5a3, d5nd5b3
   automated match to d1itza2
   complexed with mg, tpp

Details for d5nd5b2

PDB Entry: 5nd5, 1.74 Å

PDB Description: crystal structure of transketolase from chlamydomonas reinhardtii in complex with tpp and mg2+

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d5nd5b2:

Sequence; same for both SEQRES and ATOM records:

>d5nd5b2 c.36.1.0 (B:388-579) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
lpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgdf
qkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalseag
vvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrpt
tialsrqnmpni

Timeline for d5nd5b2:

• d5nd5b2 is new in SCOPe 2.06-stable
  
• d5nd5b2 appears in SCOPe 2.07
  
• d5nd5b2 appears in the current release, SCOPe 2.08