SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nyya1 (5nyy A:20-302)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2291792Species Thermomonospora curvata [TaxId:471852] [335093] (2 PDB entries)
  8. 2291793Domain d5nyya1: 5nyy A:20-302 [335094]
    Other proteins in same PDB: d5nyya2
    automated match to d1y1hx_
    complexed with act, ca, cd, mpd, mrd

Details for d5nyya1

PDB Entry: 5nyy (more details), 1.28 Å

PDB Description: formylglycine generating enzyme from t. curvata in complex with cd(ii)
PDB Compounds: (A:) Non-specific serine/threonine protein kinase

SCOPe Domain Sequences for d5nyya1:

Sequence, based on SEQRES records: (download)

>d5nyya1 d.169.1.0 (A:20-302) automated matches {Thermomonospora curvata [TaxId: 471852]}
mvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsnrqfaafvkatgyvtda
erygwsfvfhahvapgtpvmdavvpeapwwvavpgaywkapegpgssitdrpnhpvvhvs
wndavayatwagkrlpteaewemaarggldqarypwgneltprgrhrcniwqgtfpvhdt
gedgytgtapvnafapngyglynvagnvwewcadwwsadwhatespatridprgpetgta
rvtkggsflchesycnryrvaartcntpdssaahtgfrcaadp

Sequence, based on observed residues (ATOM records): (download)

>d5nyya1 d.169.1.0 (A:20-302) automated matches {Thermomonospora curvata [TaxId: 471852]}
mvaipggtfrmggedpdafpedgegpvrtvrlspflidryavsnrqfaafvkatgyvtda
erygwsfvfhahvvvpeapwwvavpgaywkapegpgssitdrpnhpvvhvswndavayat
wagkrlpteaewemaarggldqarypwgneltprgrhrcniwqgtfpvhdtgedgytgta
pvnafapngyglynvagnvwewcadwwsadwhatespatridprgpetgtarvtkggsfl
chesycnryrvaartcntpdssaahtgfrcaadp

SCOPe Domain Coordinates for d5nyya1:

Click to download the PDB-style file with coordinates for d5nyya1.
(The format of our PDB-style files is described here.)

Timeline for d5nyya1:

  • d5nyya1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5nyya2