Lineage for d5nd6a2 (5nd6 A:388-579)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446486Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2446487Protein automated matches [227126] (21 species)
    not a true protein
  7. 2446570Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [335084] (2 PDB entries)
  8. 2446572Domain d5nd6a2: 5nd6 A:388-579 [335087]
    Other proteins in same PDB: d5nd6a3, d5nd6b3
    automated match to d1itza2
    complexed with edo

Details for d5nd6a2

PDB Entry: 5nd6 (more details), 1.58 Å

PDB Description: crystal structure of apo transketolase from chlamydomonas reinhardtii
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5nd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nd6a2 c.36.1.0 (A:388-579) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
lpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgdf
qkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalseag
vvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrpt
tialsrqnmpni

SCOPe Domain Coordinates for d5nd6a2:

Click to download the PDB-style file with coordinates for d5nd6a2.
(The format of our PDB-style files is described here.)

Timeline for d5nd6a2: