SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n8aa1 (5n8a A:1-120)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051200Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 protein domains)
    barrel, closed; n=5, S=10
  6. 2051392Protein automated matches [190206] (8 species)
    not a true protein
  7. 2051402Species Human (Homo sapiens) [TaxId:9606] [186959] (26 PDB entries)
  8. 2291781Domain d5n8aa1: 5n8a A:1-120 [335082]
    Other proteins in same PDB: d5n8aa2
    automated match to d2b3ga_

Details for d5n8aa1

PDB Entry: 5n8a (more details), 1.28 Å

PDB Description: structure of rpa70n in complex with primpol (fragment 480-560)
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d5n8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n8aa1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d5n8aa1:

Click to download the PDB-style file with coordinates for d5n8aa1.
(The format of our PDB-style files is described here.)

Timeline for d5n8aa1:

  • d5n8aa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08