SCOPe 2.06: Domain d5g5ab1: 5g5a B:2-83

Lineage for d5g5ab1 (5g5a B:2-83)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries)

8. Domain d5g5ab1: 5g5a B:2-83 [335081]
   Other proteins in same PDB: d5g5aa2, d5g5ab2, d5g5ac2, d5g5ad2
   automated match to d5agya1
   complexed with gsh

Details for d5g5ab1

PDB Entry: 5g5a, 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide

PDB Compounds: (B:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ab1:

Sequence; same for both SEQRES and ATOM records:

>d5g5ab1 c.47.1.0 (B:2-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
npvcesliqieyidevwpsktp

Timeline for d5g5ab1:

• d5g5ab1 is new in SCOPe 2.06-stable
  
• d5g5ab1 appears in SCOPe 2.07
  
• d5g5ab1 appears in the current release, SCOPe 2.08