Lineage for d5g5ab1 (5g5a B:2-83)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2120090Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (16 PDB entries)
  8. 2291780Domain d5g5ab1: 5g5a B:2-83 [335081]
    Other proteins in same PDB: d5g5aa2, d5g5ab2, d5g5ac2, d5g5ad2
    automated match to d5agya1
    complexed with gsh

Details for d5g5ab1

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide
PDB Compounds: (B:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ab1 c.47.1.0 (B:2-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
npvcesliqieyidevwpsktp

SCOPe Domain Coordinates for d5g5ab1:

Click to download the PDB-style file with coordinates for d5g5ab1.
(The format of our PDB-style files is described here.)

Timeline for d5g5ab1:

  • d5g5ab1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08