Lineage for d5k0ra_ (5k0r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (20 species)
    not a true protein
  7. 2080599Species Shewanella oneidensis [TaxId:211586] [187764] (9 PDB entries)
  8. 2291779Domain d5k0ra_: 5k0r A: [335080]
    automated match to d3kruc_
    complexed with 8k6, fnr

Details for d5k0ra_

PDB Entry: 5k0r (more details), 1.45 Å

PDB Description: crystal structure of reduced shewanella yellow enzyme 4 (sye4)
PDB Compounds: (A:) NAD(P)H:flavin oxidoreductase Sye4

SCOPe Domain Sequences for d5k0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0ra_ c.1.4.0 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
svenlfdtyklndtitlknrilmapltrcmadanlvptddmvayyarraeagliiseati
irpdaqgypntpgiftqaqiagwrkvtdavhanggkifvqlwhtgrvahphffgggdvla
psaqkiegsvprmreltyvtpkavtvediqglvrdyakaaenvieagfdgveihgangyl
idqflhhdsnrrtdeyggtpvnmsrfalevvdaiiarighdrtglrispgayfnmasdsr
drvvfdyllpelekrdlafvhigifddsiefdylggtassyvrahygktlvgvgsysaet
askaiaedkfdliaigrpfianpdyvakvrnseelvaysdemlasli

SCOPe Domain Coordinates for d5k0ra_:

Click to download the PDB-style file with coordinates for d5k0ra_.
(The format of our PDB-style files is described here.)

Timeline for d5k0ra_:

  • d5k0ra_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08