SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k55a_ (5k55 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219721Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2219722Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2219723Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 protein domains)
  6. 2219929Protein automated matches [190281] (5 species)
    not a true protein
  7. 2219933Species Human (Homo sapiens) [TaxId:9606] [187709] (24 PDB entries)
  8. 2291775Domain d5k55a_: 5k55 A: [335076]
    automated match to d1fsaa_
    complexed with f6p; mutant

Details for d5k55a_

PDB Entry: 5k55 (more details), 1.98 Å

PDB Description: human muscle fructose-1,6-bisphosphatase e69q mutant in active r-state in complex with fructose-6-phosphate
PDB Compounds: (A:) Fructose-1,6-bisphosphatase isozyme 2

SCOPe Domain Sequences for d5k55a_:

Sequence, based on SEQRES records: (download)

>d5k55a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmekgrqakgtgeltqllnsmltaikaissavrkaglahlygiagsvnvtgd
qvkkldvlsnslvinmlqssystcvlvseenkdaiitakekrgkyvvcfdpldgssnidc
lasigtifaiyrktsedepsekdalqcgrnivaagyalygsatlvalstgqgvdlfmldp
algefvlvekdvkikkkgkiyslnegyakyfdaatteyvqkkkfpedgsapygaryvgsm
vadvhrtlvyggiflypanqkspkgklrllyecnpvayiieqagglattgtqpvldvkpe
aihqrvplilgspedvqeyltcvqkn

Sequence, based on observed residues (ATOM records): (download)

>d5k55a_ e.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmltltryvmgeltqllnsmltaikaissavrkavkkldvlsnslvinmlqssystcvlv
seenkdaiitakekrgkyvvcfdpldgdclasigtifaiyrktsekdalqcgrnivaagy
alygsatlvalstgqgvdlfmldpalgefvlvekdvkikkkgkiyslnegyakyfdaatt
eyvqkkkfpedgsapygaryvgsmvadvhrtlvyggiflypanqkspkgklrllyecnpv
ayiieqagglattgtqpvldvkpeaihqrvplilgspedvqeyltcvqkn

SCOPe Domain Coordinates for d5k55a_:

Click to download the PDB-style file with coordinates for d5k55a_.
(The format of our PDB-style files is described here.)

Timeline for d5k55a_:

  • d5k55a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08