SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5ja_ (5g5j A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (35 PDB entries)
  8. 2291774Domain d5g5ja_: 5g5j A: [335075]
    automated match to d1w0ea_
    complexed with hem, mf8

Details for d5g5ja_

PDB Entry: 5g5j (more details), 2.6 Å

PDB Description: crystal structure of human cyp3a4 bound to metformin
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d5g5ja_:

Sequence, based on SEQRES records: (download)

>d5g5ja_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdv
qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd

Sequence, based on observed residues (ATOM records): (download)

>d5g5ja_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesdflqlmid
sqhkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkap
ptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrd
pkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfs
fkpcketqiplklslggllqpekpvvlkvesrd

SCOPe Domain Coordinates for d5g5ja_:

Click to download the PDB-style file with coordinates for d5g5ja_.
(The format of our PDB-style files is described here.)

Timeline for d5g5ja_:

  • d5g5ja_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08