SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5ac1 (5g5a C:2-83)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (163 species)
    not a true protein
  7. 2120090Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (15 PDB entries)
  8. 2291773Domain d5g5ac1: 5g5a C:2-83 [335073]
    Other proteins in same PDB: d5g5aa2, d5g5ab2, d5g5ac2, d5g5ad2
    automated match to d5agya1
    complexed with gsh

Details for d5g5ac1

PDB Entry: 5g5a (more details), 1.95 Å

PDB Description: glutathione transferase u25 from arabidopsis thaliana in complex with glutathione disulfide
PDB Compounds: (C:) glutathione s-transferase u25

SCOPe Domain Sequences for d5g5ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ac1 c.47.1.0 (C:2-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
adevilldfwpsmfgmrtrialeeknvkfdyreqdlwnkspillemnpvhkkipvlihng
npvcesliqieyidevwpsktp

SCOPe Domain Coordinates for d5g5ac1:

Click to download the PDB-style file with coordinates for d5g5ac1.
(The format of our PDB-style files is described here.)

Timeline for d5g5ac1:

  • d5g5ac1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08