Lineage for d5jy5b1 (5jy5 B:2-104)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879421Species Cryptococcus neoformans [TaxId:235443] [335068] (1 PDB entry)
  8. 2879423Domain d5jy5b1: 5jy5 B:2-104 [335070]
    Other proteins in same PDB: d5jy5a2, d5jy5b2
    automated match to d1syra_
    complexed with gol, so4, trs

Details for d5jy5b1

PDB Entry: 5jy5 (more details), 1.8 Å

PDB Description: crystal structure of thioredoxin 1 from cryptococcus neoformans at 1.8 angstroms resolution
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5jy5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jy5b1 c.47.1.0 (B:2-104) automated matches {Cryptococcus neoformans [TaxId: 235443]}
vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe
diakeaqikamptfvaykdgkvietvtgavpakinalldkvaa

SCOPe Domain Coordinates for d5jy5b1:

Click to download the PDB-style file with coordinates for d5jy5b1.
(The format of our PDB-style files is described here.)

Timeline for d5jy5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jy5b2