Lineage for d5kbxb_ (5kbx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (71 species)
    not a true protein
  7. 2291757Species Saccharomyces cerevisiae [TaxId:559292] [335058] (1 PDB entry)
  8. 2291762Domain d5kbxb_: 5kbx B: [335064]
    Other proteins in same PDB: d5kbxa_
    automated match to d4euka_
    complexed with gol, po4

Details for d5kbxb_

PDB Entry: 5kbx (more details), 2.8 Å

PDB Description: co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1
PDB Compounds: (B:) Osmolarity two-component system protein SSK1

SCOPe Domain Sequences for d5kbxb_:

Sequence, based on SEQRES records: (download)

>d5kbxb_ c.23.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigiqkslnnshsnlekgtskrfsqapviivaltasnsqmdk
rkallsgcndyltkpvnlhalskkitewgcmqalidfdswk

Sequence, based on observed residues (ATOM records): (download)

>d5kbxb_ c.23.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigskrfsqapviivaltasnsqmdkrkallsgcndyltkpv
nlhalskkitewgcmqalidfdswk

SCOPe Domain Coordinates for d5kbxb_:

Click to download the PDB-style file with coordinates for d5kbxb_.
(The format of our PDB-style files is described here.)

Timeline for d5kbxb_:

  • d5kbxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08