SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kbxb_ (5kbx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (70 species)
    not a true protein
  7. 2291757Species Saccharomyces cerevisiae [TaxId:559292] [335058] (1 PDB entry)
  8. 2291762Domain d5kbxb_: 5kbx B: [335064]
    Other proteins in same PDB: d5kbxa_
    automated match to d4euka_
    complexed with gol, po4

Details for d5kbxb_

PDB Entry: 5kbx (more details), 2.8 Å

PDB Description: co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1
PDB Compounds: (B:) Osmolarity two-component system protein SSK1

SCOPe Domain Sequences for d5kbxb_:

Sequence, based on SEQRES records: (download)

>d5kbxb_ c.23.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigiqkslnnshsnlekgtskrfsqapviivaltasnsqmdk
rkallsgcndyltkpvnlhalskkitewgcmqalidfdswk

Sequence, based on observed residues (ATOM records): (download)

>d5kbxb_ c.23.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
vlsgieaakqirdfekqngigskrfsqapviivaltasnsqmdkrkallsgcndyltkpv
nlhalskkitewgcmqalidfdswk

SCOPe Domain Coordinates for d5kbxb_:

Click to download the PDB-style file with coordinates for d5kbxb_.
(The format of our PDB-style files is described here.)

Timeline for d5kbxb_:

  • d5kbxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-08