SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gudd1 (5gud D:1-197)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (28 species)
    not a true protein
  7. 2291747Species Corynebacterium glutamicum [TaxId:1718] [335048] (1 PDB entry)
  8. 2291754Domain d5gudd1: 5gud D:1-197 [335055]
    Other proteins in same PDB: d5guda2, d5gudb2, d5gudc2, d5gudd2, d5gudf2
    automated match to d3r3ja1
    complexed with 2it, cit, k, ndp

Details for d5gudd1

PDB Entry: 5gud (more details), 1.68 Å

PDB Description: glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/nadp+ complex)
PDB Compounds: (D:) glutamate dehydrogenase

SCOPe Domain Sequences for d5gudd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gudd1 c.58.1.0 (D:1-197) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
ghyrrmanqhesgvltg

SCOPe Domain Coordinates for d5gudd1:

Click to download the PDB-style file with coordinates for d5gudd1.
(The format of our PDB-style files is described here.)

Timeline for d5gudd1:

  • d5gudd1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-08