SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vn2c1 (5vn2 C:2-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2094544Species Brucella melitensis [TaxId:224914] [236934] (2 PDB entries)
  8. 2291744Domain d5vn2c1: 5vn2 C:2-254 [335045]
    Other proteins in same PDB: d5vn2b2, d5vn2c2
    automated match to d3rshb_
    complexed with act, edo, nad

Details for d5vn2c1

PDB Entry: 5vn2 (more details), 1.9 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier protein] reductase from brucella melitensis in complex with nad
PDB Compounds: (C:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d5vn2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vn2c1 c.2.1.0 (C:2-254) automated matches {Brucella melitensis [TaxId: 224914]}
srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs
aihadgglsiakl

SCOPe Domain Coordinates for d5vn2c1:

Click to download the PDB-style file with coordinates for d5vn2c1.
(The format of our PDB-style files is described here.)

Timeline for d5vn2c1:

  • d5vn2c1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01