SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vc0a_ (5vc0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (35 PDB entries)
  8. 2291742Domain d5vc0a_: 5vc0 A: [335043]
    automated match to d1w0ea_
    complexed with hem, rit

Details for d5vc0a_

PDB Entry: 5vc0 (more details), 2.7 Å

PDB Description: crystal structure of human cyp3a4 bound to ritonavir
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d5vc0a_:

Sequence, based on SEQRES records: (download)

>d5vc0a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdv
qqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmf
ipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrf
almnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

Sequence, based on observed residues (ATOM records): (download)

>d5vc0a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
rvdflqlmidsqnskalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqe
eidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvv
vmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmk
lalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesr

SCOPe Domain Coordinates for d5vc0a_:

Click to download the PDB-style file with coordinates for d5vc0a_.
(The format of our PDB-style files is described here.)

Timeline for d5vc0a_:

  • d5vc0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01