Lineage for d5nlwa1 (5nlw A:3-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (134 PDB entries)
  8. 2291740Domain d5nlwa1: 5nlw A:3-118 [335041]
    Other proteins in same PDB: d5nlwa2
    automated match to d3ogog_
    complexed with so4

Details for d5nlwa1

PDB Entry: 5nlw (more details), 1.5 Å

PDB Description: structure of nb36 crystal form 2
PDB Compounds: (A:) nanobody Nb36

SCOPe Domain Sequences for d5nlwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nlwa1 b.1.1.1 (A:3-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnslkpedtadyfcnllgattmsnavwgqgtqvtvs

SCOPe Domain Coordinates for d5nlwa1:

Click to download the PDB-style file with coordinates for d5nlwa1.
(The format of our PDB-style files is described here.)

Timeline for d5nlwa1:

  • d5nlwa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5nlwa2