Lineage for d5wsda1 (5wsd A:1-114)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070342Family b.82.1.10: TM1459-like [101976] (3 protein domains)
  6. 2291657Protein automated matches [334958] (1 species)
    not a true protein
  7. 2291658Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)
  8. 2291737Domain d5wsda1: 5wsd A:1-114 [335038]
    Other proteins in same PDB: d5wsda2
    automated match to d1vj2a_

Details for d5wsda1

PDB Entry: 5wsd (more details), 1.2 Å

PDB Description: crystal structure of a cupin protein (tm1459) in apo form
PDB Compounds: (A:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wsda1 b.82.1.10 (A:1-114) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d5wsda1:

Click to download the PDB-style file with coordinates for d5wsda1.
(The format of our PDB-style files is described here.)

Timeline for d5wsda1:

  • d5wsda1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5wsda2
View in 3D
Domains from other chains:
(mouse over for more information)
d5wsdb_