SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wsda1 (5wsd A:1-114)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070342Family b.82.1.10: TM1459-like [101976] (3 protein domains)
  6. 2291657Protein automated matches [334958] (1 species)
    not a true protein
  7. 2291658Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)
  8. 2291737Domain d5wsda1: 5wsd A:1-114 [335038]
    Other proteins in same PDB: d5wsda2
    automated match to d1vj2a_

Details for d5wsda1

PDB Entry: 5wsd (more details), 1.2 Å

PDB Description: crystal structure of a cupin protein (tm1459) in apo form
PDB Compounds: (A:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wsda1 b.82.1.10 (A:1-114) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d5wsda1:

Click to download the PDB-style file with coordinates for d5wsda1.
(The format of our PDB-style files is described here.)

Timeline for d5wsda1:

  • d5wsda1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5wsda2
View in 3D
Domains from other chains:
(mouse over for more information)
d5wsdb_