Lineage for d5tchc_ (5tch C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2291594Species Mycobacterium tuberculosis [TaxId:83332] [334895] (5 PDB entries)
  8. 2291732Domain d5tchc_: 5tch C: [335033]
    automated match to d2ekcb_
    complexed with fmt, mli; mutant

Details for d5tchc_

PDB Entry: 5tch (more details), 2.35 Å

PDB Description: crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form, trpa-g66v mutant
PDB Compounds: (C:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5tchc_:

Sequence, based on SEQRES records: (download)

>d5tchc_ c.1.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvm
dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaastmg
vtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalt
eglprlraltgelaagvrl

Sequence, based on observed residues (ATOM records): (download)

>d5tchc_ c.1.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpvm
dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
elaagvrl

SCOPe Domain Coordinates for d5tchc_:

Click to download the PDB-style file with coordinates for d5tchc_.
(The format of our PDB-style files is described here.)

Timeline for d5tchc_:

  • d5tchc_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01