Lineage for d5tcge_ (5tcg E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2291594Species Mycobacterium tuberculosis [TaxId:83332] [334895] (5 PDB entries)
  8. 2291728Domain d5tcge_: 5tcg E: [335029]
    automated match to d2ekcb_
    complexed with cs, fmt, mli, p1t

Details for d5tcge_

PDB Entry: 5tcg (more details), 2.4 Å

PDB Description: crystal structure of tryptophan synthase from m. tuberculosis - aminoacrylate-bound form
PDB Compounds: (E:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5tcge_:

Sequence, based on SEQRES records: (download)

>d5tcge_ c.1.2.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaastmgv
tgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalte
glprlraltgelaagvr

Sequence, based on observed residues (ATOM records): (download)

>d5tcge_ c.1.2.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaasqaap
elvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltgel
aagvr

SCOPe Domain Coordinates for d5tcge_:

Click to download the PDB-style file with coordinates for d5tcge_.
(The format of our PDB-style files is described here.)

Timeline for d5tcge_:

  • d5tcge_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01