Lineage for d5tcja_ (5tcj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2291594Species Mycobacterium tuberculosis [TaxId:83332] [334895] (5 PDB entries)
  8. 2291726Domain d5tcja_: 5tcj A: [335027]
    automated match to d2ekcb_
    complexed with 79v, cs, fmt, mli, p1t

Details for d5tcja_

PDB Entry: 5tcj (more details), 2.4 Å

PDB Description: crystal structure of tryptophan synthase from m. tuberculosis - aminoacrylate and brd4592-bound form
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5tcja_:

Sequence, based on SEQRES records: (download)

>d5tcja_ c.1.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaastmg
vtgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalt
eglprlraltgelaagvrlg

Sequence, based on observed residues (ATOM records): (download)

>d5tcja_ c.1.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
easrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgm
dgptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaa
gglglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaassqa
apelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltg
elaagvrlg

SCOPe Domain Coordinates for d5tcja_:

Click to download the PDB-style file with coordinates for d5tcja_.
(The format of our PDB-style files is described here.)

Timeline for d5tcja_:

  • d5tcja_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01