SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n16b1 (5n16 B:193-319)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 2291572Species Candida albicans [TaxId:5476] [334873] (4 PDB entries)
  8. 2291724Domain d5n16b1: 5n16 B:193-319 [335025]
    Other proteins in same PDB: d5n16a2, d5n16b2, d5n16c2, d5n16d2
    automated match to d5feaa_
    complexed with 8fn, gol, ni

Details for d5n16b1

PDB Entry: 5n16 (more details), 1.76 Å

PDB Description: first bromodomain (bd1) from candida albicans bdf1 bound to a dibenzothiazepinone (compound 1)
PDB Compounds: (B:) Bromodomain-containing factor 1

SCOPe Domain Sequences for d5n16b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n16b1 a.29.2.0 (B:193-319) automated matches {Candida albicans [TaxId: 5476]}
apkppqepdmnnlpenpipqhqakfvlntikavkrnreavpflhpvdtvklnvpfyynyi
prpmdlstierkinlkayedvsqvvddfnlmvknckkfngeaagiskmatniqaqfeklm
vkvppke

SCOPe Domain Coordinates for d5n16b1:

Click to download the PDB-style file with coordinates for d5n16b1.
(The format of our PDB-style files is described here.)

Timeline for d5n16b1:

  • d5n16b1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01