SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n02d_ (5n02 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2291563Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)
  8. 2291723Domain d5n02d_: 5n02 D: [335024]
    automated match to d1poib_
    complexed with act

Details for d5n02d_

PDB Entry: 5n02 (more details), 1.9 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb c56s variant
PDB Compounds: (D:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5n02d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n02d_ c.124.1.0 (D:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylasvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg

SCOPe Domain Coordinates for d5n02d_:

Click to download the PDB-style file with coordinates for d5n02d_.
(The format of our PDB-style files is described here.)

Timeline for d5n02d_:

  • d5n02d_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01