Lineage for d5n02d_ (5n02 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151246Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2151247Protein automated matches [191112] (14 species)
    not a true protein
  7. 2291563Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)
  8. 2291723Domain d5n02d_: 5n02 D: [335024]
    automated match to d1poib_
    complexed with act

Details for d5n02d_

PDB Entry: 5n02 (more details), 1.9 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb c56s variant
PDB Compounds: (D:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5n02d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n02d_ c.124.1.0 (D:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylasvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg

SCOPe Domain Coordinates for d5n02d_:

Click to download the PDB-style file with coordinates for d5n02d_.
(The format of our PDB-style files is described here.)

Timeline for d5n02d_:

  • d5n02d_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01