SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wsec_ (5wse C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070342Family b.82.1.10: TM1459-like [101976] (3 protein domains)
  6. 2291657Protein automated matches [334958] (1 species)
    not a true protein
  7. 2291658Species Thermotoga maritima [TaxId:243274] [334959] (3 PDB entries)
  8. 2291722Domain d5wsec_: 5wse C: [335023]
    Other proteins in same PDB: d5wseb2
    automated match to d1vj2a_
    complexed with os

Details for d5wsec_

PDB Entry: 5wse (more details), 1.12 Å

PDB Description: crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i
PDB Compounds: (C:) Uncharacterized protein tm1459

SCOPe Domain Sequences for d5wsec_:

Sequence, based on SEQRES records: (download)

>d5wsec_ b.82.1.10 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

Sequence, based on observed residues (ATOM records): (download)

>d5wsec_ b.82.1.10 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
milkraydvtpqkkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpweheifvlk
gkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge

SCOPe Domain Coordinates for d5wsec_:

Click to download the PDB-style file with coordinates for d5wsec_.
(The format of our PDB-style files is described here.)

Timeline for d5wsec_:

  • d5wsec_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01