SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tcfe_ (5tcf E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2291594Species Mycobacterium tuberculosis [TaxId:83332] [334895] (5 PDB entries)
  8. 2291718Domain d5tcfe_: 5tcf E: [335019]
    automated match to d2ekcb_
    complexed with fmt, k, mli

Details for d5tcfe_

PDB Entry: 5tcf (more details), 2.46 Å

PDB Description: crystal structure of tryptophan synthase from m. tuberculosis - ligand-free form
PDB Compounds: (E:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5tcfe_:

Sequence, based on SEQRES records: (download)

>d5tcfe_ c.1.2.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaastmgv
tgardavsqaapelvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalte
glprlraltgelaagvr

Sequence, based on observed residues (ATOM records): (download)

>d5tcfe_ c.1.2.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
asrlgpvfdscrannraaligylptgypdvpasvaamtalvesgcdiievgvpysdpgmd
gptiarateaalrggvrvrdtlaaveaisiaggravvmtywnpvlrygvdafardlaaag
glglitpdlipdeaqqwlaaseehrldriflvapsstperlaatveasrgfvyaasqaap
elvgrvkavsdipvgvglgvrsraqaaqiaqyadgvivgsalvtalteglprlraltgel
aagvr

SCOPe Domain Coordinates for d5tcfe_:

Click to download the PDB-style file with coordinates for d5tcfe_.
(The format of our PDB-style files is described here.)

Timeline for d5tcfe_:

  • d5tcfe_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-01