Lineage for d5vn2b1 (5vn2 B:1-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (236 species)
    not a true protein
  7. 2094544Species Brucella melitensis [TaxId:224914] [236934] (2 PDB entries)
  8. 2291699Domain d5vn2b1: 5vn2 B:1-254 [335000]
    Other proteins in same PDB: d5vn2b2, d5vn2c2
    automated match to d4onea_
    complexed with act, edo, nad

Details for d5vn2b1

PDB Entry: 5vn2 (more details), 1.9 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier protein] reductase from brucella melitensis in complex with nad
PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d5vn2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vn2b1 c.2.1.0 (B:1-254) automated matches {Brucella melitensis [TaxId: 224914]}
msrqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksd
laavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvff
tqavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaear
igvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatg
saihadgglsiakl

SCOPe Domain Coordinates for d5vn2b1:

Click to download the PDB-style file with coordinates for d5vn2b1.
(The format of our PDB-style files is described here.)

Timeline for d5vn2b1:

  • d5vn2b1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-01