Lineage for d5vn2d_ (5vn2 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846249Species Brucella melitensis [TaxId:224914] [236934] (2 PDB entries)
  8. 2846257Domain d5vn2d_: 5vn2 D: [334984]
    Other proteins in same PDB: d5vn2b2, d5vn2c2
    automated match to d4onea_
    complexed with act, edo, nad

Details for d5vn2d_

PDB Entry: 5vn2 (more details), 1.9 Å

PDB Description: crystal structure of 3-oxoacyl-[acyl-carrier protein] reductase from brucella melitensis in complex with nad
PDB Compounds: (D:) 3-oxoacyl-(acyl-carrier protein) reductase

SCOPe Domain Sequences for d5vn2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vn2d_ c.2.1.0 (D:) automated matches {Brucella melitensis [TaxId: 224914]}
srqrpvalvtggrrgiglgiaralaakgfdlaitdresdeavihelrglggkvaffksdl
aavktheatvfavldafggidclvnnagmgavergdflalkpenfdtimdvnlrgtvfft
qavvkamlaadevrfprsivtissvssvmtsperldyciskagltafvqglalrlaeari
gvfevrpgiirtdmtakvaarydaliegglvpmkrwgeasdvgaivaglaggdfifatgs
aihadgglsiakl

SCOPe Domain Coordinates for d5vn2d_:

Click to download the PDB-style file with coordinates for d5vn2d_.
(The format of our PDB-style files is described here.)

Timeline for d5vn2d_: