SCOPe 2.06: Domain d5n03d_: 5n03 D:

Lineage for d5n03d_ (5n03 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (14 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)

8. Domain d5n03d_: 5n03 D: [334969]
   automated match to d1poib_
   complexed with act

Details for d5n03d_

PDB Entry: 5n03, 2.1 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb c56v variant

PDB Compounds: (D:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5n03d_:

Sequence; same for both SEQRES and ATOM records:

>d5n03d_ c.124.1.0 (D:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylavvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg

Timeline for d5n03d_:

• d5n03d_ is new in SCOPe 2.06-stable
  
• d5n03d_ appears in SCOPe 2.07
  
• d5n03d_ appears in the current release, SCOPe 2.08