Lineage for d5mzwd_ (5mzw D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169699Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2169700Protein automated matches [191112] (14 species)
    not a true protein
  7. 2169812Species Myxococcus xanthus [TaxId:246197] [334864] (8 PDB entries)
  8. 2169814Domain d5mzwd_: 5mzw D: [334962]
    automated match to d1poib_
    complexed with gol

Details for d5mzwd_

PDB Entry: 5mzw (more details), 1.52 Å

PDB Description: crystal structure of the decarboxylase aiba/aibb
PDB Compounds: (D:) Glutaconate CoA-transferase family, subunit B

SCOPe Domain Sequences for d5mzwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzwd_ c.124.1.0 (D:) automated matches {Myxococcus xanthus [TaxId: 246197]}
ditpaetvvsllarqiddggvvatgvasplailaiavarathapdltylacvgsldpeip
tllpssedlgyldgrsaeitipdlfdharrgrvdtvffgaaevdaegrtnmtasgsldkp
rtkfpgvagaatlrqwvrrpvllvprqsrrnlvpevqvattrdprrpvtlisdlgvfelg
asgarllarhpwasaahiaertgfafqvsealsvtslpdartvaairaidphgyrdalvg

SCOPe Domain Coordinates for d5mzwd_:

Click to download the PDB-style file with coordinates for d5mzwd_.
(The format of our PDB-style files is described here.)

Timeline for d5mzwd_: